Structure of PDB 8b3o Chain NNN Binding Site BS01

Receptor Information
>8b3o Chain NNN (length=35) Species: 10863 (Enterobacteria phage f1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Ligand information
>8b3o Chain SSS (length=24) Species: 10863 (Enterobacteria phage f1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AMVVVIVGATIGIKLFKKFTSKAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b3o Cryo-electron microscopy of the f1 filamentous phage reveals insights into viral infection and assembly.
Resolution2.97 Å
Binding residue
(original residue number in PDB)
I22 W26 I37
Binding residue
(residue number reindexed from 1)
I7 W11 I22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0016020 membrane
GO:0019029 helical viral capsid
GO:0033644 host cell membrane

View graph for
Cellular Component
External links
PDB RCSB:8b3o, PDBe:8b3o, PDBj:8b3o
PDBsum8b3o
PubMed37169795
UniProtP69540|CAPSD_BPF1 Capsid protein G8P (Gene Name=VIII)

[Back to BioLiP]