Structure of PDB 8tpj Chain N Binding Site BS01

Receptor Information

>8tpj Chain N (length=160) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SIVTKSIVNADAEARYLSPGELDRIKAFVTGGAARLRIAETLTGSRETIV
KQAGDRLFQKRPDIVSPGGNAYGEEMTATCLRDMDYYLRLVTYGVVSGDV
TPIEEIGLVGVREMYRSLGTPIEAVAQSVREMKEVASGLMSSDDAAEASA
YFDFVIGKMS

Ligand information

>8tpj Chain R (length=4) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRFI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8tpj Structural and quantum chemical basis for OCP-mediated quenching of phycobilisomes.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	E76 M77
Binding residue (residue number reindexed from 1)	E75 M76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8tpj, PDBe:8tpj, PDBj:8tpj
PDBsum	8tpj
PubMed	38578996
UniProt	Q01951\|PHAA_SYNY3 Allophycocyanin alpha chain (Gene Name=apcA)

[Back to BioLiP]