Structure of PDB 8snh Chain N Binding Site BS01

Receptor Information
>8snh Chain N (length=181) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDG
KRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRG
GKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRT
NDGDTKIMQSIAAKLSNKDIAAISSYIQGLH
Ligand information
>8snh Chain O (length=16) Species: 287 (Pseudomonas aeruginosa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AIAKRLEPVGKVCVQG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8snh Structure of the bc 1 - cbb 3 respiratory supercomplex from Pseudomonas aeruginosa.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		M105 A106 P108 V111 P136 Y196 G199 L200 H201
Binding residue
(residue number reindexed from 1)		M85 A86 P88 V91 P116 Y176 G179 L180 H181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8snh, PDBe:8snh, PDBj:8snh
PDBsum8snh
PubMed37751552
UniProtP00106|CYC4_PSEAE Cytochrome c4 (Gene Name=cc4)

[Back to BioLiP]