Structure of PDB 8ipx Chain N Binding Site BS01

Receptor Information
>8ipx Chain N (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLDKEQVRKAVDALLTHCKSRKNNYGLLLNENESLFLMVVLWKIPSKELR
VRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNKHGIKTVSQI
ISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKV
PVSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIEN
IVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIFSSFV
Ligand information
>8ipx Chain x (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuucuuuuuuuuuuuuuuu
uuuuuuu
..................................................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		M67 E77 K140 R163 L164 P166 R171 Y174 R176 S187 K188 F252 E256 K257 A260
Binding residue
(residue number reindexed from 1)		M38 E48 K111 R134 L135 P137 R142 Y145 R147 S158 K159 F223 E227 K228 A231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0045296 cadherin binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001649 osteoblast differentiation
GO:0032880 regulation of protein localization
GO:0042981 regulation of apoptotic process
GO:2000772 regulation of cellular senescence
Cellular Component
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtO76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 (Gene Name=RSL1D1)

[Back to BioLiP]