Structure of PDB 8i0z Chain N Binding Site BS01

Receptor Information
>8i0z Chain N (length=107) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYS
ASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQ
GTKVEIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0z Structure of beta-arrestin in complex with a phosphopeptide
Resolution4.33 Å
Binding residue
(original residue number in PDB)
S31 R67
Binding residue
(residue number reindexed from 1)
S30 R66
External links