Structure of PDB 8i0p Chain N Binding Site BS01

Receptor Information

>8i0p Chain N (length=134) Species: 9606 (Homo sapiens)

APPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRY
IFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTR
DTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS

Ligand information

>8i0p Chain F (length=95)

gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcg

<<<<<.<<<..>>>>>>>>...............................
...........<<<.....>>>.......................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8i0p Molecular Basis for the activation of Human spliceosome
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): G39 N112 F113 T115 N116 I118 S143
• Binding residue (residue number reindexed from 1): G30 N103 F104 T106 N107 I109 S134

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016922 nuclear receptor binding
• GO:0030374 nuclear receptor coactivator activity

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045893 positive regulation of DNA-templated transcription
• GO:2000825 positive regulation of androgen receptor activity

Cellular Component

• GO:0000785 chromatin
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:8i0p, PDBe:8i0p, PDBj:8i0p
• PDBsum: 8i0p
• PubMed: 39068178
• UniProt: P41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)