Structure of PDB 8hxx Chain N Binding Site BS01

Receptor Information
>8hxx Chain N (length=375) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KELLEKDSKGNIIKLNEPSTISEDSKVSVTGLPLNKGPSEKIKRESLWNY
RKRNDLKTFLTENMTEESNIRSTIGWNDFENEDFCSACNQSGSFLCCDTC
PKSFHFLCLDPPIDPNNLPKGDWHCNECKFKIFINNSMATLKKIESNFIK
QNNNVKIFAKLLFNIDSHNPKQFQLPNYIKETFPAVKTGSRGQYSDENDK
IPLTDRQLFNTSYGQSITKLDSYNPDTHIDSNSGKFLICYKCNQTRLGSW
SHPENSRLIMTCDYCQTPWHLDCVPRASFKNLGSKWKCPLHSPTKVYKKI
HNYKVWKKQRLINKKNQLYYEPLQKIGYQNNGNIQIIPTTNSIKYDFFDK
IYKSKMVQKRKLFQFQESLIDKLVS
Ligand information
>8hxx Chain E (length=19) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTGKAPRKQLATKAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hxx Structure of histone deacetylase complex Rpd3S bound to nucleosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G270 S271 F272 L273 C274 D276
Binding residue
(residue number reindexed from 1)		G92 S93 F94 L95 C96 D98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060195 negative regulation of antisense RNA transcription
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0032221 Rpd3S complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hxx, PDBe:8hxx, PDBj:8hxx
PDBsum8hxx
PubMed37798513
UniProtQ04779|RCO1_YEAST Transcriptional regulatory protein RCO1 (Gene Name=RCO1)

[Back to BioLiP]