Structure of PDB 8hih Chain N Binding Site BS01

Receptor Information

>8hih Chain N (length=217) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDA
RNDLSSGRGLCRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLLSTG
PAEIDARLRLVVGDQESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFE
LLKYLAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGPEHE
ALIGTVRNVGYKAVRPA

Ligand information

>8hih Chain K (length=77) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cttcgtcacggcggcgaaacaacgaggggcttccaccgaaaccgcgctgc
gttataatgggagctgtcacggatgca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8hih Structural insights into the transcription activation mechanism of the global regulator GlnR from actinobacteria.
Resolution	3.66 Å
Binding residue (original residue number in PDB)	T151 Y152 K153 W179 R188 T189 V192 H193 R196 N214
Binding residue (residue number reindexed from 1)	T145 Y146 K147 W173 R182 T183 V186 H187 R190 N208

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000156	phosphorelay response regulator activity
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding

	Biological Process
GO:0000160	phosphorelay signal transduction system
GO:0006355	regulation of DNA-templated transcription
GO:0042128	nitrate assimilation
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hih, PDBe:8hih, PDBj:8hih
PDBsum	8hih
PubMed	37216560
UniProt	O53830

[Back to BioLiP]