Structure of PDB 8gam Chain N Binding Site BS01

Receptor Information
>8gam Chain N (length=205) Species: 486 (Neisseria lactamica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFILEISGDLACFTRSELKVERVSYPVITPSAARNILMAILWKPAIRWKV
LKIEILKPIQWTNIRRNEVGTKMSERSGSLYIEDNRQQRASMLLKDVAYR
IHADFDMTSEAGESDNYVKFAEMFKRRAKKGQYFHQPYLGCREFPCDFRL
LEKAEDGLPLEDITQDFGFMLYDMDFSKSDPRDSNNAEPMFYQCKAVNGV
ITVPP
Ligand information
>8gam Chain K (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guugaaacagggucagcuugccguagguggcaucgcccucguc
...........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gam Exploiting activation and inactivation mechanisms in type I-C CRISPR-Cas3 for genome-editing applications.
Resolution3.46 Å
Binding residue
(original residue number in PDB)		R23 N36 M39 W43 R67 N68 E69 V70 T72 K73 Q89 F135 Y139 G141 C142 R143 E144 F177 R183
Binding residue
(residue number reindexed from 1)		R22 N35 M38 W42 R66 N67 E68 V69 T71 K72 Q88 F134 Y138 G140 C141 R142 E143 F176 R182
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8gam, PDBe:8gam, PDBj:8gam
PDBsum8gam
PubMed38242128
UniProtD0W8X4

[Back to BioLiP]