Structure of PDB 7w5a Chain N Binding Site BS01

Receptor Information
>7w5a Chain N (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS
Ligand information
>7w5a Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w5a Mechanism of exon ligation by human spliceosome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		G39 R41 K42 Q95 G96 E98 T111 N112 T115 N116 C117 I118 V121 P122 K125 L126 T135 H136 S143
Binding residue
(residue number reindexed from 1)		G39 R41 K42 Q95 G96 E98 T111 N112 T115 N116 C117 I118 V121 P122 K125 L126 T135 H136 S143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5a, PDBe:7w5a, PDBj:7w5a
PDBsum7w5a
PubMed35705093
UniProtP41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)

[Back to BioLiP]