Structure of PDB 7tbh Chain N Binding Site BS01

Receptor Information
>7tbh Chain N (length=243) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQDLRSHLVHKLVQAIFPCPDPCALKDRRMENLVAYAKKVEGDMYESANS
RDEYYHLLAEKIYKIQKELEEKSQVRQNYHQDAEAAINRQINLELYASYV
YLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQ
DIKKPDRDDWCSGLNAMESALHLEKSVNQSLLELHKLATDKNDPHLCDFI
ETYYLSEQVKSIKELGDHVTNLRKMGAPCAGMAEYLFDKHTLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tbh Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y63 Y71 K75 Q89 F156 Q158
Binding residue
(residue number reindexed from 1)		Y55 Y63 K67 Q81 F148 Q150
Enzymatic activity
Enzyme Commision number 1.16.3.1: ferroxidase.
2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0004322 ferroxidase activity
GO:0005506 iron ion binding
GO:0008198 ferrous iron binding
GO:0008199 ferric iron binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0140315 iron ion sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006955 immune response
GO:0008285 negative regulation of cell population proliferation
GO:0048147 negative regulation of fibroblast proliferation
GO:0110076 negative regulation of ferroptosis
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0044754 autolysosome
GO:0071682 endocytic vesicle lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tbh, PDBe:7tbh, PDBj:7tbh
PDBsum7tbh
PubMed35233453
UniProtP09528|FRIH_MOUSE Ferritin heavy chain (Gene Name=Fth1);
Q92793|CBP_HUMAN CREB-binding protein (Gene Name=CREBBP)

[Back to BioLiP]