Structure of PDB 7r6k Chain N Binding Site BS01

Receptor Information

>7r6k Chain N (length=92) Species: 1247190 (Saccharomyces cerevisiae BY4741)

EELQRKKQSDVLRFLQRVRVWEYRQKNVIHRVRVRRGNRKRPVNELKYQR
SLRATAEERVGRSYWVNQDSTYKYFEVREARGLTATGKKSRG

Ligand information

>7r6k Chain 1 (length=152)

gcugaacuuaagcauaaagcggagucgaguuguuugcagcucuaagcuac
ggugaucgucgaaggggcgaaagacaagauggggaagcuccguuucaaug
uugagcuugacucuaguuguggggaguaaaguuaccacaucgugagacag
gu

<<<.....<......>.>>>......<<<<<<<..>>>>>>>.....<.<
<<...>>>.....>...<....>........<<<....>>>.......<<
<.<<<<<<..<<<<.<...>..>>>>..>>>>>.>.>>><<....>>...
..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7r6k Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
• Resolution: 3.17 Å
• Binding residue (original residue number in PDB): R12 K14 Q15 N34 V35 R67 R68 G69 N70 K93 Q95 R96 S97 L98 R105 R108 A161 R162 K170 S171 R172
• Binding residue (residue number reindexed from 1): R5 K7 Q8 N27 V28 R35 R36 G37 N38 K47 Q49 R50 S51 L52 R59 R62 A80 R81 K89 S90 R91

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r6k, PDBe:7r6k, PDBj:7r6k
• PDBsum: 7r6k
• PubMed: 36482249
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)