Structure of PDB 7jzv Chain N Binding Site BS01

Receptor Information
>7jzv Chain N (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAV
LLPK
Ligand information
>7jzv Chain X (length=139) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gatgtatatatctgacacgtgcctggagactagggagtaatccccttggc
ggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagc
tgtctacgaccaattgagcggcctcggcaccgggattct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jzv BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		K15 S16 R17 R20 G28 R32 R42
Binding residue
(residue number reindexed from 1)		K1 S2 R3 R6 G14 R18 R28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jzv, PDBe:7jzv, PDBj:7jzv
PDBsum7jzv
PubMed33589814
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]