Structure of PDB 7eto Chain N Binding Site BS01

Receptor Information
>7eto Chain N (length=66) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VAVFFEPHEENVLRCPERVLRRLLEDAAVTMRGGGWREDVLMDRVRKRYL
RQELRDLGHRVQTYCE
Ligand information
>7eto Chain H (length=20) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRQLAQSVQDTIQHMRFLYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eto Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		K58 R62 L65 R66 L68 V72 C76
Binding residue
(residue number reindexed from 1)		K47 R51 L54 R55 L57 V61 C65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
Cellular Component
GO:0019028 viral capsid

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eto, PDBe:7eto, PDBj:7eto
PDBsum7eto
PubMed34315863
UniProtA0A3G6XKK5

[Back to BioLiP]