Structure of PDB 7etj Chain N Binding Site BS01

Receptor Information
>7etj Chain N (length=76) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVTMRGGGWREDV
LMDRVRKRYLRQELRDLGHRVQTYCE
Ligand information
>7etj Chain H (length=20) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRQLAQSVQDTIQHMRFLYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7etj Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R62 L65 R66 G69 Q73 C76
Binding residue
(residue number reindexed from 1)		R61 L64 R65 G68 Q72 C75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
Cellular Component
GO:0019028 viral capsid

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7etj, PDBe:7etj, PDBj:7etj
PDBsum7etj
PubMed34315863
UniProtA0A3G6XKK5

[Back to BioLiP]