Structure of PDB 7et3 Chain N Binding Site BS01

Receptor Information
>7et3 Chain N (length=65) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVFFEPHEENVLRCPERVLRRLLEDAAVTMRGGGWREDVLMDRVRKRYLR
QELRDLGHRVQTYCE
Ligand information
>7et3 Chain H (length=20) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRQLAQSVQDTIQHMRFLYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et3 Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		K58 R62 R66 G69 V72 Q73 C76
Binding residue
(residue number reindexed from 1)		K46 R50 R54 G57 V60 Q61 C64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
GO:0019073 viral DNA genome packaging
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7et3, PDBe:7et3, PDBj:7et3
PDBsum7et3
PubMed34315863
UniProtP16726|CVC2_HCMVA Capsid vertex component 2 (Gene Name=CVC2)

[Back to BioLiP]