Structure of PDB 6zvi Chain N Binding Site BS01

Receptor Information
>6zvi Chain N (length=63) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDIL
VLMESEREARRLR
Ligand information
>6zvi Chain f (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuugacaaauuuuuuuuuuaaacugg
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zvi EDF1 coordinates cellular responses to ribosome collisions.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R64 R67
Binding residue
(residue number reindexed from 1)		R60 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zvi, PDBe:6zvi, PDBj:6zvi
PDBsum6zvi
PubMed32744497
UniProtQ3E7X9|RS28A_YEAST Small ribosomal subunit protein eS28A (Gene Name=RPS28A)

[Back to BioLiP]