Structure of PDB 6uri Chain N Binding Site BS01

Receptor Information
>6uri Chain N (length=164) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRDLEKHNTAANNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSH
FLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTF
GWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRL
AFHHVARELHPEYF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uri Structural basis of CD4 downregulation by HIV-1 Nef.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
S34 R35 D36 L37 H40 N47 N51 L76 P78 M79 Y81 F121 D123 W124 N126 F139
Binding residue
(residue number reindexed from 1)
S1 R2 D3 L4 H7 N8 N12 L37 P39 M40 Y42 F82 D84 W85 N87 F100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6uri, PDBe:6uri, PDBj:6uri
PDBsum6uri
PubMed32719457
UniProtP03406|NEF_HV1BR Protein Nef (Gene Name=nef)

[Back to BioLiP]