Structure of PDB 6rpb Chain N Binding Site BS01

Receptor Information
>6rpb Chain N (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYS
DGDKEDGRFTAQLNRASQYVSLLIRDSQPSDSATYLCAVKSGGSYIPTFG
RGTSLIVHPYIQNPDPAVYQLSVCLFTDFDSQTNVSQSKDSDVYITDKCV
LDMMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rpb TCRs with Distinct Specificity Profiles Use Different Binding Modes to Engage an Identical Peptide-HLA Complex.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q37 K107 G109 Y114
Binding residue
(residue number reindexed from 1)		Q29 K90 G92 Y95
External links