Structure of PDB 6oem Chain N Binding Site BS01

Receptor Information
>6oem Chain N (length=36) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSAFFLFCSEYRPKIKGEHPGIGDVAKKLGEMWNNT
Ligand information
>6oem Chain G (length=57) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgggtttttgtctggcttcacacttgatttgcatcactgtgtaagacagg
ccagatc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oem Cutting antiparallel DNA strands in a single active site.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		F102 A126 K127 G130 W133 N134
Binding residue
(residue number reindexed from 1)		F4 A26 K27 G30 W33 N34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6oem, PDBe:6oem, PDBj:6oem
PDBsum6oem
PubMed32015552
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]