Structure of PDB 6ocp Chain N Binding Site BS01

Receptor Information
>6ocp Chain N (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSLAKDSKGRFFIDRDGF
LFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ocp Structural basis for auxiliary subunit KCTD16 regulation of the GABABreceptor.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
Q34 F80
Binding residue
(residue number reindexed from 1)
Q12 F50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051260 protein homooligomerization

View graph for
Biological Process
External links
PDB RCSB:6ocp, PDBe:6ocp, PDBj:6ocp
PDBsum6ocp
PubMed30971491
UniProtQ68DU8|KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 (Gene Name=KCTD16)

[Back to BioLiP]