Structure of PDB 6kco Chain N Binding Site BS01

Receptor Information
>6kco Chain N (length=83) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASYSIGDLVFAKVKGYPPWPAKITKSNNKKYNVYFYGTGETANIKLEDLF
PYASNKERFATEKIMKRAKFIEAIDQIESALRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kco Shuguo PWWP in complex with ssDNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)
I72 M73 K77
Binding residue
(residue number reindexed from 1)
I64 M65 K69
Enzymatic activity
Enzyme Commision number ?
External links