Structure of PDB 6gov Chain N Binding Site BS01

Receptor Information
>6gov Chain N (length=110) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSMDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSR
VESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCSGRQ
KIKGKSIPLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gov Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R76 K98
Binding residue
(residue number reindexed from 1)		R79 K101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003727 single-stranded RNA binding
GO:0005515 protein binding
GO:0035613 RNA stem-loop binding
GO:0070063 RNA polymerase binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006357 regulation of transcription by RNA polymerase II
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6gov, PDBe:6gov, PDBj:6gov
PDBsum6gov
PubMed30795892
UniProtP03045|REGN_LAMBD Antitermination protein N (Gene Name=N)

[Back to BioLiP]