Structure of PDB 6cg0 Chain N Binding Site BS01

Receptor Information
>6cg0 Chain N (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYAFFVQTCREEHKKKSVNFSEFSKKCSERWKKRPPSAFFLFCSEYRPKI
KGEHPGLSIGDVAKKLGEMWNNTAA
Ligand information
>6cg0 Chain G (length=60) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgggtttttgtctggcttcacacttgatttgcatcactgtgtaagacagg
ccagatccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cg0 Cracking the DNA Code for V(D)J Recombination.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		A17 Q21 S35 V36 F38 N134
Binding residue
(residue number reindexed from 1)		A3 Q7 S17 V18 F20 N71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6cg0, PDBe:6cg0, PDBj:6cg0
PDBsum6cg0
PubMed29628308
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]