Structure of PDB 6buz Chain N Binding Site BS01

Receptor Information
>6buz Chain N (length=134) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQRQRKESVVQHLIH
LCEEKRSDAALLDIIYMQFHQHQKMKQFKNSFKKVTVSFRETAVWIRIAW
GTKPNQYKPTYVVYYSQRRNTPLLGQALTIASKH
Ligand information
>6buz Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6buz Structural mechanisms of centromeric nucleosome recognition by the kinetochore protein CENP-N.
Resolution3.92 Å
Binding residue
(original residue number in PDB)		M18 K45 R169 R170
Binding residue
(residue number reindexed from 1)		M18 K41 R118 R119
Binding affinityPDBbind-CN: Kd=0.046uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015144 carbohydrate transmembrane transporter activity
Biological Process
GO:0007059 chromosome segregation
GO:0008643 carbohydrate transport
GO:0034080 CENP-A containing chromatin assembly
GO:0055085 transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6buz, PDBe:6buz, PDBj:6buz
PDBsum6buz
PubMed29269420
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q96H22|CENPN_HUMAN Centromere protein N (Gene Name=CENPN)

[Back to BioLiP]