Structure of PDB 5ze0 Chain N Binding Site BS01

Receptor Information
>5ze0 Chain N (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAKEKGKFED
MAKADKARYEREMKRPPSAFFLFCSEYRPKIKGEIGDVAKKLGEMWNNTD
DKQPYEKKAAKLKEKYEK
Ligand information
>5ze0 Chain G (length=54) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggtttttgtctggcttcacacttgatttgcatcactgtgtaagacaggcc
agat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ze0 Cracking the DNA Code for V(D)J Recombination
Resolution2.75 Å
Binding residue
(original residue number in PDB)		Q21 K28 F38 F102 K127
Binding residue
(residue number reindexed from 1)		Q12 K19 F29 F70 K90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5ze0, PDBe:5ze0, PDBj:5ze0
PDBsum5ze0
PubMed29628308
UniProtP63158|HMGB1_MOUSE High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]