Structure of PDB 5x8p Chain N Binding Site BS01

Receptor Information

>5x8p Chain N (length=134) Species: 3562 (Spinacia oleracea)

LSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGR
RAMTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGR
ILYEISGVAENIARRAVAIAASKMPIRTQFIISG

Ligand information

>5x8p Chain B (length=117)

uucugguguccuaggcguagaggaaccacaccaauccaucccgaacuugg
ugguuaaacucuacugcggugacgauacuguaggggagguccugcggaaa
aauagcucgacgccagg

.<<<<<<<<<....<<<<<<<<.....<<<<<<<............>>>>
>.>>....>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>...
....>>>.>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): R16 M17 K18 G19 Y22 E38
• Binding residue (residue number reindexed from 1): R15 M16 K17 G18 Y21 E37

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0009507 chloroplast
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
• PDBsum: 5x8p
• PubMed: 28582576
• UniProt: P17353|RK16_SPIOL Large ribosomal subunit protein uL16c (Gene Name=rpl16)