Structure of PDB 5u07 Chain N Binding Site BS01

Receptor Information
>5u07 Chain N (length=241) Species: 269800 (Thermobifida fusca YX) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPL
DRYKELKFTVRVDRPGVRLVDFHTIGGGLPKERTVPTAAGERRDPKKATI
VTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVL
RRRVADPVRELVEAVPLPHRRVEEDAATVLVDLIYEEGTLTVLNDVPLSF
DSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQNKLFTYVKQ
Ligand information
>5u07 Chain K (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auggaccgccagugauaaguggaaugccaugugggcugucgagccccacg
cacgugggg
...........................................<<<<<<.
...>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u07 Structure Basis for Directional R-loop Formation and Substrate Handover Mechanisms in Type I CRISPR-Cas System.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G16 E17 H18 S19 M20 S33 G34 G37 M38 A41 R47 F73 H74 T75 I76 G77 G78 G79 R105 W134 P136 Y137 G139 R140 R141 N201 F207 S209 R212 Y214
Binding residue
(residue number reindexed from 1)		G15 E16 H17 S18 M19 S32 G33 G36 M37 A40 R46 F72 H73 T74 I75 G76 G77 G78 R104 W133 P135 Y136 G138 R139 R140 N194 F200 S202 R205 Y207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5u07, PDBe:5u07, PDBj:5u07
PDBsum5u07
PubMed28666122
UniProtQ47PJ4

[Back to BioLiP]