Structure of PDB 5ms0 Chain N Binding Site BS01

Receptor Information
>5ms0 Chain N (length=85) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSRVESA
LNPIADLTVAEYHKQIESNLQRIERKNQRTWYSKP
Ligand information
>5ms0 Chain R (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucuuuaaaaauaagcccugaagaagggc
..............<<<<<.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ms0 Structural basis for lambda N-dependent processive transcription antitermination.
Resolution9.8 Å
Binding residue
(original residue number in PDB)		A2 A3 Q4 R8 K14
Binding residue
(residue number reindexed from 1)		A1 A2 Q3 R7 K13
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ms0, PDBe:5ms0, PDBj:5ms0
PDBsum5ms0
PubMed28452979
UniProtP03045|REGN_LAMBD Antitermination protein N (Gene Name=N)

[Back to BioLiP]