Structure of PDB 5mq0 Chain N Binding Site BS01

Receptor Information
>5mq0 Chain N (length=227) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSN
NIIKTLICVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEE
AKNDMMKRFLSLKNVKLGGAQITSDPSEADNIVDKLKNILLKNPSTKSFF
LYNIDASIPEWKITDTVSQLLLSLIVNHKAKCGGLRFQSSELGERFVSKI
IFIIPWSSTAENIKLSLSLNKLIQLEL
Ligand information
>5mq0 Chain 6 (length=99) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuuau
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mq0 Structure of a spliceosome remodelled for exon ligation.
Resolution4.17 Å
Binding residue
(original residue number in PDB)		G31 H45 K47 R51 N53 K57 M108
Binding residue
(residue number reindexed from 1)		G28 H42 K44 R48 N50 K54 M105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mq0, PDBe:5mq0, PDBj:5mq0
PDBsum5mq0
PubMed28076345
UniProtP38241|SLT11_YEAST Pre-mRNA-splicing factor SLT11 (Gene Name=ECM2)

[Back to BioLiP]