Structure of PDB 5lsj Chain N Binding Site BS01

Receptor Information
>5lsj Chain N (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKTIKAKQEILKQYHP
VVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGEGFSQ
V
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lsj Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		K109 E112 D113 F115 D116
Binding residue
(residue number reindexed from 1)		K6 E9 D10 F12 D13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000070 mitotic sister chromatid segregation
Cellular Component
GO:0000776 kinetochore

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lsj, PDBe:5lsj, PDBj:5lsj
PDBsum5lsj
PubMed27881301
UniProtQ96IY1|NSL1_HUMAN Kinetochore-associated protein NSL1 homolog (Gene Name=NSL1)

[Back to BioLiP]