Structure of PDB 5lj5 Chain N Binding Site BS01

Receptor Information

>5lj5 Chain N (length=209) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNI
IKTLICVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVVMTEEAKNDMM
KRFLSLKNVKLGGAQITSDPSEADNIVDKLKNILLSFFLYNSIPEWKITD
TVSQLLSLIVNHKAKCGGLRFQSSELGERFVSKIFIIPWSTAENIKLSLS
LNKLIQLEL

Ligand information

>5lj5 Chain V (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuu

<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>..................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lj5 Cryo-EM structure of the spliceosome immediately after branching.
Resolution	10.0 Å
Binding residue (original residue number in PDB)	I28 L43 H45 K47 R51 M108
Binding residue (residue number reindexed from 1)	I23 L38 H40 K42 R46 M99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0017070	U6 snRNA binding
GO:0036002	pre-mRNA binding

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0000974	Prp19 complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0071006	U2-type catalytic step 1 spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
PDBsum	5lj5
PubMed	27459055
UniProt	P38241\|SLT11_YEAST Pre-mRNA-splicing factor SLT11 (Gene Name=ECM2)

[Back to BioLiP]