Structure of PDB 4p2r Chain N Binding Site BS01

Receptor Information
>4p2r Chain N (length=196) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDQVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFRKNSRGSLINLFYLA
SGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAEASNTNKVVFG
TGTRLQVLPNIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYI
TDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p2r Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
Resolution3.295 Å
Binding residue
(original residue number in PDB)
R29 S91 N92 N94
Binding residue
(residue number reindexed from 1)
R30 S92 N93 N95
External links