Structure of PDB 4m7a Chain N Binding Site BS01

Receptor Information

>4m7a Chain N (length=67) Species: 559292 (Saccharomyces cerevisiae S288C)

MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKL
NEIYIRGTFIKFIKLQD

Ligand information

>4m7a Chain O (length=5)

guuuu

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4m7a Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
• Resolution: 2.781 Å
• Binding residue (original residue number in PDB): W35 N37 R72 T74
• Binding residue (residue number reindexed from 1): W35 N37 R56 T58

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006396 RNA processing

External links

• PDB: RCSB:4m7a, PDBe:4m7a, PDBj:4m7a
• PDBsum: 4m7a
• PubMed: 24240276
• UniProt: P40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 (Gene Name=LSM4)