Structure of PDB 4ilm Chain N Binding Site BS01

Receptor Information
>4ilm Chain N (length=274) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPLIFKIGYNVIPLQDVILPTPSSKVLKYLIQSGKLIPSLKDLITSRDKY
KPIFISHLGFNQRRIFQKTITKGSRLSSIIAFSTQANVLSEVADEGIFET
VYGKFHIMIESIEIVEVEKLKEEVEKHMNDNIRVRFVSPTLLSSKVLLPP
SLSERYKKIHAGYSTLPSVGLIVAYAYNVYCNLIGKKEVEVRAFKFGILS
NALSRIIGYDLHPVTVAIGELRKARGVMGWIEFDIPDERLKRRALNYLLT
SSYLGIGRSRGIGFGEIRLEFRKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ilm Recognition and cleavage of a nonstructured CRISPR RNA by its processing endoribonuclease Cas6.
Resolution3.068 Å
Binding residue
(original residue number in PDB)		K28 R47 D48 K49 Y50 K51 S148 K150 V151 S158 G167 Y168 Y180 H217 T220 R232 K233 A234 R235 R268 S269 R270 G271
Binding residue
(residue number reindexed from 1)		K28 R47 D48 K49 Y50 K51 S143 K145 V146 S153 G162 Y163 Y175 H212 T215 R222 K223 A224 R225 R258 S259 R260 G261
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ilm, PDBe:4ilm, PDBj:4ilm
PDBsum4ilm
PubMed23454186
UniProtQ97WV8|CAS6B_SACS2 CRISPR-associated endoribonuclease Cas6 2 (Gene Name=cas6b)

[Back to BioLiP]