Structure of PDB 3pqy Chain N Binding Site BS01

Receptor Information
>3pqy Chain N (length=174) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTTQPDSMESTEGETVHLPCSHATISGNEYIYWYRQVPLQGPEYVTHGLQ
QNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILSGGSNYKLTFGK
GTLLTVTPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTYITDKCVLDMR
SMDFKSNSAVAWSNKSDFACANAF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pqy Structural basis for enabling T-cell receptor diversity within biased virus-specific CD8+ T-cell responses
Resolution3.192 Å
Binding residue
(original residue number in PDB)
Y40 S107 G109 S110 Y112
Binding residue
(residue number reindexed from 1)
Y32 S89 G91 S92 Y94
Enzymatic activity
Enzyme Commision number ?
External links