Structure of PDB 3jqo Chain N Binding Site BS01

Receptor Information
>3jqo Chain N (length=130) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDK
VVGVRNNNFAPGRGAVATGTASPDVRRVQI
Ligand information
>3jqo Chain O (length=24) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HKPPPEPDWSNTVPVNKTIPVDTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jqo Structure of the outer membrane complex of a type IV secretion system
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T174 Y182 Y184 V185 M186 S187 E188 Q189 H199 V200 W201 R208 R254 R256 D259 G263 R265
Binding residue
(residue number reindexed from 1)		T14 Y22 Y24 V25 M26 S27 E28 Q29 H39 V40 W41 R48 R94 R96 D99 G103 R105
Enzymatic activity
Enzyme Commision number ?
External links