Structure of PDB 3e3q Chain N Binding Site BS01

Receptor Information
>3e3q Chain N (length=111) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSY
GAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLY
FGAGTRLSVLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e3q Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		N30 Y50 G96 G97
Binding residue
(residue number reindexed from 1)		N30 Y50 G95 G96
External links