Structure of PDB 2wwa Chain N Binding Site BS01

Receptor Information
>2wwa Chain N (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKS
IACVLTVINEQQREAVRQL
Ligand information
>2wwa Chain D (length=63) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaacgcagcgaaaugcgauacguaaugugaauugcagaauuccgugaau
caucgaaucuuug
.<<<<<<........>>>.....<.<<....<<......>>.........
.>>..>...>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wwa Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
Resolution8.9 Å
Binding residue
(original residue number in PDB)		R10 S40 P42 K45 R48 K49 A52 C53 L55 N59 R63
Binding residue
(residue number reindexed from 1)		R10 S40 P42 K45 R48 K49 A52 C53 L55 N59 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wwa, PDBe:2wwa, PDBj:2wwa
PDBsum2wwa
PubMed19933108
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]