Structure of PDB 2ww9 Chain N Binding Site BS01

Receptor Information

>2ww9 Chain N (length=69) Species: 4932 (Saccharomyces cerevisiae)

MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKS
IACVLTVINEQQREAVRQL

Ligand information

>2ww9 Chain D (length=63)

agaacgcagcgaaaugcgauacguaaugugaauugcagaauuccgugaau
caucgaaucuuug

.<<<<<<........>>>.....<.<<....<<<....>>>.........
.>>..>...>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2ww9 Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
• Resolution: 8.6 Å
• Binding residue (original residue number in PDB): Y7 R10 P39 S40 L41 P42 K45 R48 K49 A52 C53 L55 R63
• Binding residue (residue number reindexed from 1): Y7 R10 P39 S40 L41 P42 K45 R48 K49 A52 C53 L55 R63

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2ww9, PDBe:2ww9, PDBj:2ww9
• PDBsum: 2ww9
• PubMed: 19933108
• UniProt: P0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)