Structure of PDB 2hrp Chain N Binding Site BS01

Receptor Information
>2hrp Chain N (length=224) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLVESGGGLVQPGGSRKLSCAASGFTFMRFGMHWVRQAPEKGLEWVAY
ISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTALYYCARSG
GIERYDGTYYVMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTL
GCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPR
PSETVTCNVAHPASSTKVDKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hrp Three-dimensional structure of an Fab-peptide complex: structural basis of HIV-1 protease inhibition by a monoclonal antibody.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y50 Y58 D100B G100C T100D Y100F
Binding residue
(residue number reindexed from 1)		Y50 Y59 D106 G107 T108 Y110
External links