Structure of PDB 6mtd Chain MM Binding Site BS01

Receptor Information
>6mtd Chain MM (length=117) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVK
LVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD
YGKESQAKDVIEEYFKC
Ligand information
>6mtd Chain w (length=26) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKREFDRHSGSDRSTLDEWKAIQNKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtd Structures of translationally inactive mammalian ribosomes.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y114 E117
Binding residue
(residue number reindexed from 1)		Y101 E104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mtd, PDBe:6mtd, PDBj:6mtd
PDBsum6mtd
PubMed30355441
UniProtG1SFR8|RS12_RABIT Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]