Structure of PDB 8wql Chain ME Binding Site BS01

Receptor Information
>8wql Chain ME (length=36) Species: 153964 (Arthrospira sp. FACHB-439) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEVNDLGFVASILFVLVPSVFLLILYIQTQSREGKE
Ligand information
>8wql Chain TE (length=29) Species: 153964 (Arthrospira sp. FACHB-439) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ESVAYILVLTLALGVLFFAIAFREPPRIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wql Structure of in situ PBS-PSII supercomplex at 3.5 Angstroms resolution.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		V3 F8
Binding residue
(residue number reindexed from 1)		V3 F8
External links