Structure of PDB 8wfx Chain M Binding Site BS01

Receptor Information
>8wfx Chain M (length=296) Species: 78331 (Mycobacterium canetti) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNSRLFRFDVVRTHFGDHGLESSTIGCPADTLYSALCVEALRMGGQQLLD
ELVACSTLRLTDLLPYVGPDYLVPKPLKSVRSDSSSLQKKLAKKIGFLPA
AQLGSFLDGTADLDDLAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFR
FEPDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFIPTESEVP
AALTPTTAAASLMTLTTSLPTDDELEQALAGATYRLVKRSGFVASATYAE
TPRRKRDIYKLAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLA
Ligand information
>8wfx Chain O (length=50) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacuuaaaaccguguugcacugcaacccggaauucuugcacgucg
..................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wfx Type-III-A structure of mycobacteria CRISPR-Csm complexes involving atypical crRNAs.
Resolution3.73 Å
Binding residue
(original residue number in PDB)		G19 T31 S34 A35 C37 V38 E39 L49 K131 A132 A133 I134 H135 P143 Y144 G182 G183 R185 T186 S240 F242 V243 A244 S245 T247 R254 K255 H284 V286
Binding residue
(residue number reindexed from 1)		G19 T31 S34 A35 C37 V38 E39 L49 K131 A132 A133 I134 H135 P143 Y144 G182 G183 R185 T186 S240 F242 V243 A244 S245 T247 R254 K255 H284 V286
External links