Structure of PDB 8w34 Chain M Binding Site BS01

Receptor Information

>8w34 Chain M (length=47) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII

Ligand information

>8w34 Chain F (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtggaaaatctctagca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8w34 HIV-1 integrase assembles multiple species of stable synaptic complex intasomes that are active for concerted DNA integration in vitro.
Resolution	2.83 Å
Binding residue (original residue number in PDB)	R228 R263
Binding residue (residue number reindexed from 1)	R7 R42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0008270	zinc ion binding

	Biological Process
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8w34, PDBe:8w34, PDBj:8w34
PDBsum	8w34
PubMed	38582148
UniProt	P12497\|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]