Structure of PDB 8u5h Chain M Binding Site BS01

Receptor Information
>8u5h Chain M (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>8u5h Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRGGLGWESSLRQRPMPRLTFQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u5h Cryo-EM structure of human DNMT3A N-terminal domain bound to H2AK119Ub nucleosome
Resolution3.23 Å
Binding residue
(original residue number in PDB)		Q44 V45 H106 E110
Binding residue
(residue number reindexed from 1)		Q17 V18 H79 E83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8u5h, PDBe:8u5h, PDBj:8u5h
PDBsum8u5h
PubMed
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]