Structure of PDB 8t1o Chain M Binding Site BS01

Receptor Information
>8t1o Chain M (length=412) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNI
ARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEEN
IKNNFVLIYELLDEILDFGYPQNSETGALKTFITQHQTKEEQSQITSQVT
GQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYL
SGMPECKFGMNDKIKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFE
LMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVR
IPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELL
PTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVR
YIGRSGIYETRC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t1o Lipid nanodiscs as a template for high-resolution cryo-EM structures of peripheral membrane proteins.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		F174 W421 V422 R423
Binding residue
(residue number reindexed from 1)		F168 W398 V399 R400
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005048 signal sequence binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0044325 transmembrane transporter binding
GO:0050750 low-density lipoprotein particle receptor binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0002092 positive regulation of receptor internalization
GO:0006886 intracellular protein transport
GO:0006897 endocytosis
GO:0006900 vesicle budding from membrane
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0031623 receptor internalization
GO:0048488 synaptic vesicle endocytosis
GO:0065003 protein-containing complex assembly
GO:0072583 clathrin-dependent endocytosis
GO:0097494 regulation of vesicle size
GO:0098884 postsynaptic neurotransmitter receptor internalization
GO:1900244 positive regulation of synaptic vesicle endocytosis
GO:1903077 negative regulation of protein localization to plasma membrane
Cellular Component
GO:0005739 mitochondrion
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0008021 synaptic vesicle
GO:0009898 cytoplasmic side of plasma membrane
GO:0030122 AP-2 adaptor complex
GO:0030131 clathrin adaptor complex
GO:0030141 secretory granule
GO:0045202 synapse
GO:0098794 postsynapse
GO:0098894 extrinsic component of presynaptic endocytic zone membrane
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t1o, PDBe:8t1o, PDBj:8t1o
PDBsum8t1o
PubMed37364761
UniProtP84091|AP2M1_MOUSE AP-2 complex subunit mu (Gene Name=Ap2m1)

[Back to BioLiP]