Structure of PDB 8smr Chain M Binding Site BS01

Receptor Information

>8smr Chain M (length=204) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQLDHVDIDLTDKAAMQDGARTFANYCMGCHSAKFQRYERVATDLGIPAD
LMMEKLVFTGAKIGDHMDIGMKPADAKTWFGAAPPDLTLVARVRGTDWLY
SYLRSFYEDPKRPWGVNNVIFPNVGMPNVLAPLQGRQVIQLTVVPKTGEL
NEAQFDEKVKNLVTFLAYSANPNKLASERIGTYVLLYLAFFFVFAYLLKR
EYWK

Ligand information

>8smr Chain O (length=16) Species: 287 (Pseudomonas aeruginosa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AIAKRLEPVGKVCVQG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8smr Structure of the bc 1 - cbb 3 respiratory supercomplex from Pseudomonas aeruginosa.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	A38 Q41 R45 N49 Y50 I71 L75 K79
Binding residue (residue number reindexed from 1)	A14 Q17 R21 N25 Y26 I47 L51 K55

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:8smr, PDBe:8smr, PDBj:8smr
PDBsum	8smr
PubMed	37751552
UniProt	Q9HVY6

[Back to BioLiP]