Structure of PDB 8rg0 Chain M Binding Site BS01

Receptor Information
>8rg0 Chain M (length=32) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEIIEVDPDTKEMLKNLQVTQPTVGMNFKTPR
Ligand information
>8rg0 Chain A (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacggccgggggcauucgcggaccagagcggcauuugccaagaauguuu
ugcgaugcggcggcguugacccgccgggcagcuaaggguggugauggcgu
ucagccaguccuuuaucauua
.<<<<..<...<<<<..<..>.......<<.>>...>>>>..>..>>>.>
.<<..<.<<<<<<.<<..>>>>>>>>.>..>>.<<..........<<<..
...>>>.....>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)		V124 G125 M126 K129 R132
Binding residue
(residue number reindexed from 1)		V24 G25 M26 K29 R32
External links
PDB RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum8rg0
PubMed
UniProtP08708|RS17_HUMAN Small ribosomal subunit protein eS17 (Gene Name=RPS17)

[Back to BioLiP]