Structure of PDB 8rbx Chain M Binding Site BS01

Receptor Information
>8rbx Chain M (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQE
ASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8rbx Chain N (length=148) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gatatcgatgtatatatctgacacgtgcctggagactagggagtaatccc
cttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgc
tagagctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rbx Structural basis of Integrator-dependent RNA polymerase II termination
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R63 K64 L65 P66 R83
Binding residue
(residue number reindexed from 1)		R19 K20 L21 P22 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0030307 positive regulation of cell growth
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rbx, PDBe:8rbx, PDBj:8rbx
PDBsum8rbx
PubMed38570683
UniProtQ6NXT2|H3C_HUMAN Histone H3.3C (Gene Name=H3-5)

[Back to BioLiP]